Structure of PDB 6zsd Chain XP

Receptor sequence
>6zsdXP (length=143) Species: 9606 (Homo sapiens) [Search protein sequence]
PVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQ
HHVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCL
EAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE
3D structure
PDB6zsd Structural basis of mitochondrial translation.
ChainXP
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna XP Y178 E179 Y142 E143
BS02 rna XP T85 Q86 H87 R107 W109 K112 V121 W150 S154 S156 T49 Q50 H51 R71 W73 K76 V85 W114 S118 S120
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
GO:0035928 rRNA import into mitochondrion
Cellular Component
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zsd, PDBe:6zsd, PDBj:6zsd
PDBsum6zsd
PubMed32812867
UniProtQ9H0U6|RM18_HUMAN Large ribosomal subunit protein uL18m (Gene Name=MRPL18)

[Back to BioLiP]