Structure of PDB 6osi Chain XM

Receptor sequence
>6osiXM (length=114) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRK
3D structure
PDB6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
ChainXM
Resolution4.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna XM R14 V17 Y21 G24 K27 R29 N77 R91 L96 Q101 R102 T103 R104 T105 N106 R108 K111 R114 R13 V16 Y20 G23 K26 R28 N76 R90 L95 Q100 R101 T102 R103 T104 N105 R107 K110 R113
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6osi, PDBe:6osi, PDBj:6osi
PDBsum6osi
PubMed33016876
UniProtP80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]