Structure of PDB 5czp Chain XM

Receptor sequence

>5czpXM (length=114) Species: 300852 (Thermus thermophilus HB8)

RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAE
VVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQR
TRTNARTRKGPRKT

3D structure

• PDB: 5czp Uniformity of Peptide Release Is Maintained by Methylation of Release Factors.
• Chain: XM
• Resolution: 3.29996 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XM	K13 R14 V17 Y21 I22 Y23 G24 G26 A28 R29 R44 N77 Y87 R88 R91 H92 L96 P97 V98 R99 Q101 R102 T103 R104 T105 N106 R108 T109 R110 K111 K115	K11 R12 V15 Y19 I20 Y21 G22 G24 A26 R27 R42 N75 Y85 R86 R89 H90 L94 P95 V96 R97 Q99 R100 T101 R102 T103 N104 R106 T107 R108 K109 K113

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5czp, PDBe:5czp, PDBj:5czp
• PDBsum: 5czp
• PubMed: 27681416
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)