Structure of PDB 4p70 Chain XM

Receptor sequence

>4p70XM (length=121) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGKKK

3D structure

PDB

4p70 Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.

Chain

Resolution

3.68 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	XM	R14 Y21 Y23 G24 I25 G26 A28 R29 R44 V74 Y87 R88 R91 H92 L96 P97 V98 R99 G100 Q101 R102 T103 R104 T105 N106 A107 R108 T109 R110 K111 R114 K115 T116 K121	R13 Y20 Y22 G23 I24 G25 A27 R28 R43 V73 Y86 R87 R90 H91 L95 P96 V97 R98 G99 Q100 R101 T102 R103 T104 N105 A106 R107 T108 R109 K110 R113 K114 T115 K120
BS02	rna	XM	D83 R93	D82 R92
BS03	rna	XM	A118 G119	A117 G118
BS04	MG	XM	G100 Q101	G99 Q100
BS05	MG	XM	R11 N12	R10 N11

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links

PDB	RCSB:4p70, PDBe:4p70, PDBj:4p70
PDBsum	4p70
PubMed	25128388
UniProt	P80377\|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)