Structure of PDB 4ypb Chain XK

Receptor sequence
>4ypbXK (length=121) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTP
YAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSI
VDDTPVPHNGCRPKKKFRKAS
3D structure
PDB4ypb Defining the mRNA recognition signature of a bacterial toxin protein.
ChainXK
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna XK Y20 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 G52 S53 K55 R85 T87 V114 H116 N117 G118 C119 R120 K122 K123 K124 S129 Y12 N18 N19 I21 T23 G29 N30 P31 W34 S36 G38 G44 S45 K47 R77 T79 V106 H108 N109 G110 C111 R112 K114 K115 K116 S121
BS02 MG XK N26 G52 N18 G44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ypb, PDBe:4ypb, PDBj:4ypb
PDBsum4ypb
PubMed26508639
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]