Structure of PDB 8fon Chain XJ

Receptor sequence

>8fonXJ (length=96) Species: 300852 (Thermus thermophilus HB8)

RIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPF
KHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT

3D structure

• PDB: 8fon Structural basis for reduced ribosomal A-site fidelity in response to P-site codon-anticodon mismatches.
• Chain: XJ
• Resolution: 3.64 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XJ	K7 H13 S35 G36 P37 I38 P39 L40 P41 R43 V44 R45 T48 R51 G52 P53 F54 K55 H56 K57 S59 R60 R70 D73	K3 H9 S31 G32 P33 I34 P35 L36 P37 R39 V40 R41 T44 R47 G48 P49 F50 K51 H52 K53 S55 R56 R66 D69

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fon, PDBe:8fon, PDBj:8fon
• PDBsum: 8fon
• PubMed: 36924943
• UniProt: Q5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)