Structure of PDB 7og4 Chain XI

Receptor sequence

>7og4XI (length=211) Species: 9606 (Homo sapiens)

SKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLI
RLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQ
VLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGG
CIDDTILSRQGFINYSKLPSLPLVQGELVGGLTCLTAQTHSLLQHQPLQL
TTLLDQYIREQ

3D structure

• PDB: 7og4 Structural basis of mitochondrial translation.
• Chain: XI
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XI	S30 K31 V33 T34 R35 R38 Q43 K46 A106 K124 V125 P127 N128 Q129 G149 H150	S1 K2 V4 T5 R6 R9 Q14 K17 A77 K95 V96 P98 N99 Q100 G120 H121
BS02	peptide	XI	L214 Q217 T218 L221 Q225	L185 Q188 T189 L192 Q196
BS03	peptide	XI	T230 L233 D234 Y236 I237 Q240	T201 L204 D205 Y207 I208 Q211
BS04	peptide	XI	L229 Y236	L200 Y207

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7og4, PDBe:7og4, PDBj:7og4
• PDBsum: 7og4
• PubMed: 32812867
• UniProt: Q7Z7H8|RM10_HUMAN Large ribosomal subunit protein uL10m (Gene Name=MRPL10)