Structure of PDB 6zsa Chain XI

Receptor sequence

>6zsaXI (length=211) Species: 9606 (Homo sapiens) [Search protein sequence]

SKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLI
RLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQ
VLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGG
CIDDTILSRQGFINYSKLPSLPLVQGELVGGLTCLTAQTHSLLQHQPLQL
TTLLDQYIREQ

3D structure

PDB

6zsa Structural basis of mitochondrial translation.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	XI	K31 V33 R35 R38 H41 Q43 K46 A106 K124 V125 P127 N128 G149 H150	K2 V4 R6 R9 H12 Q14 K17 A77 K95 V96 P98 N99 G120 H121
BS02	peptide	XI	L214 Q217 T218 L221 Q225	L185 Q188 T189 L192 Q196
BS03	peptide	XI	T230 L233 D234 I237 Q240	T201 L204 D205 I208 Q211
BS04	peptide	XI	L229 L232 Y236	L200 L203 Y207

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zsa, PDBe:6zsa, PDBj:6zsa
PDBsum	6zsa
PubMed	32812867
UniProt	Q7Z7H8\|RM10_HUMAN Large ribosomal subunit protein uL10m (Gene Name=MRPL10)

[Back to BioLiP]