Structure of PDB 4p70 Chain XH

Receptor sequence
>4p70XH (length=138) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYER
VDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEI
PRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB4p70 Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
ChainXH
Resolution3.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna XH M1 L2 T3 P5 D8 T11 R12 R14 N15 V19 K21 S29 R30 F31 K56 K88 P89 G90 R91 R92 Y94 G96 V97 S113 T114 S115 G128 V129 G130 E132 M1 L2 T3 P5 D8 T11 R12 R14 N15 V19 K21 S29 R30 F31 K56 K88 P89 G90 R91 R92 Y94 G96 V97 S113 T114 S115 G128 V129 G130 E132
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Wed Mar 5 10:26:56 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4p70', asym_id = 'XH', title = 'Structural insights into +1 frameshifting promot...d or modification-deficient anticodon stem loops.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4p70', asym_id='XH', title='Structural insights into +1 frameshifting promot...d or modification-deficient anticodon stem loops.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4p70', asym_id = 'XH'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4p70', asym_id='XH')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>