Structure of PDB 6i7o Chain XG

Receptor sequence

>6i7oXG (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

6i7o Collided ribosomes form a unique structural interface to induce Hel2-driven quality control pathways.

Chain

Resolution

5.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XG	V18 N20 S22 V23 S48 A50 R51 F57 H68 R94 N95 T99 N101 F104 G105 I106 G124 M125 D126 Y128 K142	V13 N15 S17 V18 S43 A45 R46 F52 H63 R89 N90 T94 N96 F99 G100 I101 G119 M120 D121 Y123 K137
BS02	rna	XG	P8 M9 R10 Q43 T44 V46 T70 R72 P134 G135 R137 R141 R143 T147 G149 N150 S151 H152	P3 M4 R5 Q38 T39 V41 T65 R67 P129 G130 R132 R136 R138 T142 G144 N145 S146 H147

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6i7o, PDBe:6i7o, PDBj:6i7o
PDBsum	6i7o
PubMed	30609991
UniProt	Q3E757\|RL11B_YEAST Large ribosomal subunit protein uL5B (Gene Name=RPL11B)

[Back to BioLiP]