Structure of PDB 5vpp Chain XE

Receptor sequence

>5vppXE (length=151) Species: 300852 (Thermus thermophilus HB8)

DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
E

3D structure

• PDB: 5vpp Mechanism of tRNA-mediated +1 ribosomal frameshifting.
• Chain: XE
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XE	R14 T16 A17 R18 M19 Q20 A21 R24 R25 R27 P49 K57 Y61 F84 G85 A86 K92 A94 T98 A102 G103 R107 L119 T120 K121 E122 L123 S125 R126 N127 Y133	R10 T12 A13 R14 M15 Q16 A17 R20 R21 R23 P45 K53 Y57 F80 G81 A82 K88 A90 T94 A98 G99 R103 L115 T116 K117 E118 L119 S121 R122 N123 Y129

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5vpp, PDBe:5vpp, PDBj:5vpp
• PDBsum: 5vpp
• PubMed: 30262649
• UniProt: Q5SHQ5|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)