Structure of PDB 6oj2 Chain XD

Receptor sequence

>6oj2XD (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

PDB

6oj2 Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	XD	G2 R3 I5 P7 V8 C9 R10 R13 R14 K22 R25 K30 R36 Y38 P40 G41 Q42 H43 R49 S52 L58 R59 Q62 R66 E72 R73 Q74 S113 R115 Q116 Q119 R122 H123 H125 V133 D134 L135 S137 Y138 E205 R209	G1 R2 I4 P6 V7 C8 R9 R12 R13 K21 R24 K29 R35 Y37 P39 G40 Q41 H42 R48 S51 L57 R58 Q61 R65 E71 R72 Q73 S112 R114 Q115 Q118 R121 H122 H124 V132 D133 L134 S136 Y137 E204 R208
BS02	SF4	XD	C9 C12 L19 L21 K22 C26 C31 A32	C8 C11 L18 L20 K21 C25 C30 A31
BS03	MG	XD	G87 T89	G86 T88

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6oj2, PDBe:6oj2, PDBj:6oj2
PDBsum	6oj2
PubMed	32601241
UniProt	P80373\|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]