Structure of PDB 6i7o Chain XC

Receptor sequence
>6i7oXC (length=99) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS
PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB6i7o Collided ribosomes form a unique structural interface to induce Hel2-driven quality control pathways.
ChainXC
Resolution5.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna XC K4 K13 G14 K15 I26 S27 Y28 K29 K30 G31 A32 A33 S34 N35 R36 T37 R41 K67 K75 R76 L77 G78 F80 R82 K3 K12 G13 K14 I25 S26 Y27 K28 K29 G30 A31 A32 S33 N34 R35 T36 R40 K66 K74 R75 L76 G77 F79 R81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i7o, PDBe:6i7o, PDBj:6i7o
PDBsum6i7o
PubMed30609991
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]