Structure of PDB 7aoi Chain XA

Receptor sequence

>7aoiXA (length=154) Species: 5691 (Trypanosoma brucei) [Search protein sequence]

NIKGGVGSFLMRRAAPKSIRQKYQTGPQFYKRKFFQFQKGHHRLHRRISG
VQTGSPTHQREYERFHHLPGDVRTRPQFDFTFGETRADRVMFAWRKRGDL
QLYQMSGRGETFVCYRCGYPVRSQLVAVKADNWDYRMCYRCYTNTVHRGM
ENDT

3D structure

PDB

7aoi Interconnected assembly factors regulate the biogenesis of mitoribosomal large subunit.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	XA	N3 I4 K5 G6 S10 R14 R15 K19 S20 R22 Y25 F31 K33 R34 K35 F36 Q38 Q40 K41 G42 H43 H44 R45 R49 S51 G52 Q54 R66 R77 G109 R110 Q126	N1 I2 K3 G4 S8 R12 R13 K17 S18 R20 Y23 F29 K31 R32 K33 F34 Q36 Q38 K39 G40 H41 H42 R43 R47 S49 G50 Q52 R64 R75 G107 R108 Q124
BS02	ZN	XA	C116 C119 C140 C143	C114 C117 C138 C141

Gene Ontology

	Cellular Component
GO:0005730	nucleolus

View graph for
Cellular Component

External links

PDB	RCSB:7aoi, PDBe:7aoi, PDBj:7aoi
PDBsum	7aoi
PubMed	33576519
UniProt	Q387S8

[Back to BioLiP]