Structure of PDB 5y6p Chain X5

Receptor sequence

>5y6pX5 (length=331) Species: 35689 (Griffithsia pacifica)

LGTVLGNSSLDKLGLDKFVDRFEVNEAGRPDGFSADYEVIIRACYMQIFA
NAYIMESERAEMAKAESEFRDGRFTVKEFCRALAKSYQYRKRFFDGRPLY
GAIELCFKHILGRTPDGLEHYRAKSAVYDTKGYEAFIDAFFDDGEYDAFY
DSYCVPFYRGHLTTSNLSMAAFTHMFQVVRGSSTSDKANPRTMTNQITLN
QAGIQSIPLAVVAPGADGATFLAPDASAGSWQTGFSGATKARTSHGSRQE
KGKMFRIEVANNTQYSAVGGGSGIKLQSRSGKFYKMRNMAPAKVSTFRRA
NNVYLVPFDELSATYIKIHKNGGSIASITPV

3D structure

• PDB: 5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
• Chain: X5
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	X5	Y93 S223 K227	Y53 S183 K187
BS02	PEB	X5	F348 Y355 I356	F308 Y315 I316
BS03	PEB	X5	S270 W271	S230 W231
BS04	PEB	X5	Q304 Y305 S335 R338	Q264 Y265 S295 R298
BS05	PEB	X5	S49 T203 M209	S9 T163 M169
BS06	PEB	X5	L139 Y140	L99 Y100
BS07	PEB	X5	K104 S107 E108 R110	K64 S67 E68 R70

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 14:28:04 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'X5', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='X5', title='Structure of phycobilisome from the red alga Griffithsia pacifica')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'X5'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='X5')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>