Structure of PDB 7ezx Chain X2

Receptor sequence

>7ezxX2 (length=177) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

PDB

7ezx Structure of the phycobilisome from the red alga Porphyridium purpureum in Middle Light

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	X2	M59 N72 R77 R78 A81 C82 D85 I88 L120 V122 P123	M59 N72 R77 R78 A81 C82 D85 I88 L120 V122 P123
BS02	PEB	X2	I67 Y74 T75 N76	I67 Y74 T75 N76
BS03	PEB	X2	N35 L38 D39 F153 A154 A155 G156 C158	N35 L38 D39 F153 A154 A155 G156 C158
BS04	PEB	X2	C50 D54 S57 G58 C61 A136 A140 E148	C50 D54 S57 G58 C61 A136 A140 E148

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ezx, PDBe:7ezx, PDBj:7ezx
PDBsum	7ezx
PubMed
UniProt	P11393\|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]