Structure of PDB 7pwo Chain X1

Receptor sequence

>7pwoX1 (length=142) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

MSKTSGLYTARKLRTVRRVNRWADKKYRKAHLGTWLKANPLEGACMARGI
VTQKIGISAKQPNSAVRKAVRVQLTKNSKKITAFVPRDGSITYIDNNDEV
LVAGFGRAGRAVGDIPGCRFKVIKVAGIGLLALFLRKREKRA

3D structure

PDB

7pwo Cryo-EM structure of the ancient eukaryotic ribosome from the human parasite Giardia lamblia.

Chain

Resolution

2.75 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X1	M1 K3 S5 Y8 R11 K12 R17 R18 N20 A23 D24 T34 C45 M46 A47 R48 K60 Q61 N63 S64 V66 R67 R87 D88 G104 G106 R107 R110 G113 D114 R119 K124 L131 K137 R138	M1 K3 S5 Y8 R11 K12 R17 R18 N20 A23 D24 T34 C45 M46 A47 R48 K60 Q61 N63 S64 V66 R67 R87 D88 G104 G106 R107 R110 G113 D114 R119 K124 L131 K137 R138

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links