Structure of PDB 8y6o Chain X

Receptor sequence
>8y6oX (length=131) Species: 9606 (Homo sapiens) [Search protein sequence]
MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDG
EVMPVVVVQSATVLDLKKAIQRYVQLKQEREGGIQHISWSYVWRTYHLTS
AGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQ
3D structure
PDB8y6o Structural basis of U12-type intron engagement by the fully assembled human minor spliceosome
ChainX
Resolution3.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X Y37 Q39 Q59 R120 Y37 Q39 Q59 R120
BS02 rna X K68 G83 I84 H86 I87 S88 S90 Y91 R109 L129 R130 K68 G83 I84 H86 I87 S88 S90 Y91 R109 L129 R130
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005689 U12-type spliceosomal complex
GO:0005829 cytosol
GO:0045171 intercellular bridge

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y6o, PDBe:8y6o, PDBj:8y6o
PDBsum8y6o
PubMed38484052
UniProtQ9BV90|SNR25_HUMAN U11/U12 small nuclear ribonucleoprotein 25 kDa protein (Gene Name=SNRNP25)

[Back to BioLiP]