Structure of PDB 8xz3 Chain X

Receptor sequence
>8xz3X (length=79) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
SSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGVNVGRGGDD
TLFALAPGAVEFGAKRGRKTVNIVPVARP
3D structure
PDB8xz3 Cryo-EM structures reveal the molecular mechanism of HflX-mediated erythromycin resistance in mycobacteria.
ChainX
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X N12 R14 S16 A18 Q19 R20 K24 F26 G27 Q29 K32 A33 G34 E35 I36 R39 R41 G42 T43 F45 G54 G55 D56 L62 P64 F69 R75 R85 N5 R7 S9 A11 Q12 R13 K17 F19 G20 Q22 K25 A26 G27 E28 I29 R32 R34 G35 T36 F38 G47 G48 D49 L55 P57 F62 R68 R78
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xz3, PDBe:8xz3, PDBj:8xz3
PDBsum8xz3
PubMed39029461
UniProtA0R150|RL27_MYCS2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]