Structure of PDB 8s8e Chain X

Receptor sequence

>8s8eX (length=144) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

GKGKPRGLNSARKLRVHRRNNRWAETTYKKRLLGTAFKSSPFGGSSHAKG
IVLEKIGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDE
VLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS

3D structure

• PDB: 8s8e Structural basis of AUC codon discrimination during translation initiation in yeast.
• Chain: X
• Resolution: 3.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	G2 K3 G4 K5 P6 R7 G8 L9 N10 R13 K14 R19 R20 N22 R23 W24 A25 E26 K30 R32 F38 S40 S46 S47 H48 A49 K50 Q63 N65 S66 A67 I68 R69 K70 R73 P88 N89 D90 G106 G108 R109 K110 K112 K114 G115 D116 R121 K126 S131 K139 K140	G1 K2 G3 K4 P5 R6 G7 L8 N9 R12 K13 R18 R19 N21 R22 W23 A24 E25 K29 R31 F37 S39 S45 S46 H47 A48 K49 Q62 N64 S65 A66 I67 R68 K69 R72 P87 N88 D89 G105 G107 R108 K109 K111 K113 G114 D115 R120 K125 S130 K138 K139

External links

• PDB: RCSB:8s8e, PDBe:8s8e, PDBj:8s8e
• PDBsum: 8s8e
• PubMed: 39193907
• UniProt: F2Z602