Structure of PDB 8s1p Chain X

Receptor sequence
>8s1pX (length=61) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
ARKCVITGKKTTAGNNRSHAMNASKRTWGANLQKVRILVNGKPKKVYVSA
RALKSGKVERV
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
ChainX
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X A2 R3 K10 T12 T13 A14 N16 R18 S19 H20 A21 M22 N23 S25 K26 R27 W29 G30 A31 N32 Q34 K35 K43 Y48 A51 R52 K55 K58 R61 A1 R2 K9 T11 T12 A13 N15 R17 S18 H19 A20 M21 N22 S24 K25 R26 W28 G29 A30 N31 Q33 K34 K42 Y47 A50 R51 K54 K57 R60
Gene Ontology
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP37807|RL28_BACSU Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]