Structure of PDB 8r6f Chain X

Receptor sequence

>8r6fX (length=140) Species: 4565 (Triticum aestivum) [Search protein sequence]

GKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVL
EKIGIEAKQPNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLI
AGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPR

3D structure

PDB

8r6f High-Resolution Structure and Internal Mobility of a Plant 40S Ribosomal Subunit.

Chain

Resolution

2.34 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	G2 K3 T4 R5 G6 G8 R11 K12 H16 R17 R18 Q20 R21 W22 A23 D24 K25 K28 S30 N34 W36 K38 S43 S44 H45 A46 K47 Q60 N62 S63 A64 I65 R66 K67 P85 N86 D87 G103 G105 R106 K107 V111 G112 D113 R118 K120 K123 S128 L130 K136 K137	G1 K2 T3 R4 G5 G7 R10 K11 H15 R16 R17 Q19 R20 W21 A22 D23 K24 K27 S29 N33 W35 K37 S42 S43 H44 A45 K46 Q59 N61 S62 A63 I64 R65 K66 P84 N85 D86 G102 G104 R105 K106 V110 G111 D112 R117 K119 K122 S127 L129 K135 K136

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links