Structure of PDB 8q7n Chain X

Receptor sequence
>8q7nX (length=81) Species: 9606 (Homo sapiens) [Search protein sequence]
ADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKS
LDKAKEEEKASKEFAAMEAAALKAYQEDLKR
3D structure
PDB8q7n New insights into the functions of B complex proteins revealed by cryo-EM of dimerized spliceosomes
ChainX
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X D3 Y4 W5 K6 S7 Q8 N23 P25 D2 Y3 W4 K5 S6 Q7 N22 P24
BS02 rna X G33 K34 G32 K33
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0070064 proline-rich region binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q7n, PDBe:8q7n, PDBj:8q7n
PDBsum8q7n
PubMed38383864
UniProtO75554|WBP4_HUMAN WW domain-binding protein 4 (Gene Name=WBP4)

[Back to BioLiP]