Structure of PDB 8g8g Chain X

Receptor sequence
>8g8gX (length=140) Species: 9606 (Homo sapiens) [Search protein sequence]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEA
LQLSFKNMCKLRPLLQKWVEEADNNENLQEIRKRKRTSIENRVRGNLENL
FLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRS
3D structure
PDB8g8g Histone modifications regulate pioneer transcription factor cooperativity.
ChainX
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna X R157 T163 Q164 C185 R232 K233 R234 T235 I237 V273 V276 W277 N280 R18 T24 Q25 C46 R84 K85 R86 T87 I89 V125 V128 W129 N132
BS02 dna X F179 S180 T182 T183 N196 R234 K286 F40 S41 T43 T44 N57 R86 K138
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0035198 miRNA binding
GO:0043565 sequence-specific DNA binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001714 endodermal cell fate specification
GO:0001824 blastocyst development
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0009611 response to wounding
GO:0009653 anatomical structure morphogenesis
GO:0009786 regulation of asymmetric cell division
GO:0010468 regulation of gene expression
GO:0035019 somatic stem cell population maintenance
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1902894 negative regulation of miRNA transcription
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g8g, PDBe:8g8g, PDBj:8g8g
PDBsum8g8g
PubMed37225990
UniProtQ01860|PO5F1_HUMAN POU domain, class 5, transcription factor 1 (Gene Name=POU5F1)

[Back to BioLiP]