Structure of PDB 8csu Chain X

Receptor sequence

>8csuX (length=352) Species: 9606 (Homo sapiens)

AISRTNENDPAKHGDQHEGQHYNISPQDLETVFPHGLPPRFVMQVKTFSE
ACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCHVIHFCA
KQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNE
RFLNQIKVQEKYVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKE
LKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKM
MKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVS
NYNPKEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCA
YL

3D structure

• PDB: 8csu Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: X
• Resolution: 3.03 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	N164 R166 T313 F317 K318 P319 R320 S389 L390 R393	N118 R120 T267 F271 K272 P273 R274 S343 L344 R347
BS02	ATP	X	P84 M100 G131 T132 G133 K134 T135 L136 T313 Y348 P388 E392	P38 M54 G85 T86 G87 K88 T89 L90 T267 Y302 P342 E346
BS03	GDP	X	Y173 R177 V209 D238 I242 K245 K295	Y127 R131 V163 D192 I196 K199 K249

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0005525 GTP binding

Biological Process

• GO:0006915 apoptotic process
• GO:0032543 mitochondrial translation
• GO:0097190 apoptotic signaling pathway

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8csu, PDBe:8csu, PDBj:8csu
• PDBsum: 8csu
• PubMed: 36482135
• UniProt: P51398|RT29_HUMAN Small ribosomal subunit protein mS29 (Gene Name=DAP3)