Structure of PDB 8csq Chain X

Receptor sequence

>8csqX (length=352) Species: 9606 (Homo sapiens)

AISRTNENDPAKHGDQHEGQHYNISPQDLETVFPHGLPPRFVMQVKTFSE
ACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCHVIHFCA
KQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNE
RFLNQIKVQEKYVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKE
LKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKM
MKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVS
NYNPKEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCA
YL

3D structure

• PDB: 8csq Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: X
• Resolution: 2.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	K130 N164 R166 L316 F317 K318 R320 S389 L390 R393	K84 N118 R120 L270 F271 K272 R274 S343 L344 R347
BS02	ATP	X	M100 G131 G133 K134 T135 L136 S311 T313 P388 E392	M54 G85 G87 K88 T89 L90 S265 T267 P342 E346
BS03	GDP	X	Y173 R177 D238 G241 I242 N292 K295	Y127 R131 D192 G195 I196 N246 K249

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0005525 GTP binding

Biological Process

• GO:0006915 apoptotic process
• GO:0032543 mitochondrial translation
• GO:0097190 apoptotic signaling pathway

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8csq, PDBe:8csq, PDBj:8csq
• PDBsum: 8csq
• PubMed: 36482135
• UniProt: P51398|RT29_HUMAN Small ribosomal subunit protein mS29 (Gene Name=DAP3)