Structure of PDB 8cdr Chain X

Receptor sequence

>8cdrX (length=50) Species: 4932 (Saccharomyces cerevisiae)

AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI

3D structure

• PDB: 8cdr mRNA reading frame maintenance during eukaryotic ribosome translocation
• Chain: X
• Resolution: 2.04 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	A2 A3 Q4 K5 F7 K10 M13 K17 P22 I35 Y37 N38 A39 R41 R42 W44 R45 T47 K48 M49	A1 A2 Q3 K4 F6 K9 M12 K16 P21 I34 Y36 N37 A38 R40 R41 W43 R44 T46 K47 M48
BS02	rna	X	F7 R8 Q11 K12 K15 K18 Q19 R21 L23 P24 W26 I27 L29 R30 T31 K40	F6 R7 Q10 K11 K14 K17 Q18 R20 L22 P23 W25 I26 L28 R29 T30 K39

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cdr, PDBe:8cdr, PDBj:8cdr
• PDBsum: 8cdr
• PubMed: 38030725
• UniProt: P04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)