Structure of PDB 8bef Chain X |
>8befX (length=98) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
GNPIPTSAVLTASAKHIGMRCMPENVAFLKCKKNDPNPEKCLDKGRDVTR CVLGLLKDLHQKCQKEMDDYVGCMYYYTNEFDLCRKEQEAFEKVCPLK |
|
PDB | 8bef Cryo-EM structure of the respiratory I + III 2 supercomplex from Arabidopsis thaliana at 2 angstrom resolution. |
Chain | X |
Resolution | 2.13 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
Q7G |
X |
Y84 L91 |
Y76 L83 |
|
|
|
|