Structure of PDB 8azw Chain X

Receptor sequence
>8azwX (length=50) Species: 4097 (Nicotiana tabacum) [Search protein sequence]
PSHKTFMIKKKLAKKQRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF
3D structure
PDB8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
ChainX
Resolution2.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X P2 S3 H4 K5 K10 L13 I35 R36 Y37 A39 R41 R42 H43 W44 R45 T47 K48 L49 P1 S2 H3 K4 K9 L12 I34 R35 Y36 A38 R40 R41 H42 W43 R44 T46 K47 L48
BS02 rna X T6 F7 K12 K15 R18 Q19 R21 I23 P24 W26 M29 R30 T31 K40 T5 F6 K11 K14 R17 Q18 R20 I22 P23 W25 M28 R29 T30 K39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8azw, PDBe:8azw, PDBj:8azw
PDBsum8azw
PubMed37156858
UniProtA0A1S3YR32

[Back to BioLiP]