Structure of PDB 8a63 Chain X

Receptor sequence
>8a63X (length=95) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence]
MHVKKGDKVKVITGKDKGKSGKVLAAFPKKDRVLIEGINMVKKHTKPSNV
NPQGGILNVEAPIHVSNVMLLDPKTGEPTRVGYEVKGDKKVRVAK
3D structure
PDB8a63 Structural basis for HflXr-mediated antibiotic resistance in Listeria monocytogenes.
ChainX
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X H2 K4 K5 K10 I12 T13 G14 K15 A26 K29 V41 K42 K43 H44 T45 K46 G55 I56 H64 S66 N67 P78 R80 Y83 K90 K95 H2 K4 K5 K10 I12 T13 G14 K15 A26 K29 V41 K42 K43 H44 T45 K46 G55 I56 H64 S66 N67 P78 R80 Y83 K90 K95
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a63, PDBe:8a63, PDBj:8a63
PDBsum8a63
PubMed36300626
UniProtQ8Y443|RL24_LISMO Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]