Structure of PDB 7z9f Chain X |
>7z9fX (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] |
IVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRL GEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSR |
|
PDB | 7z9f Structural Basis of the Pancreatitis-Associated Autoproteolytic Failsafe Mechanism in Human Anionic Trypsin. |
Chain | X |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
3.4.21.4: trypsin. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
X |
E75 N77 V80 E85 |
E52 N54 V57 E62 |
|
|
|
|