Structure of PDB 7vy2 Chain X |
>7vy2X (length=62) Species: 39723 (Cereibacter sphaeroides f. sp. denitrificans) [Search protein sequence] |
NDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPI DENPAPAPNITG |
|
PDB | 7vy2 Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex. |
Chain | X |
Resolution | 2.75 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SPO |
X |
R20 M27 |
R13 M20 |
|
|
|