Structure of PDB 7vnm Chain X |
>7vnmX (length=52) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence] |
KTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAP NI |
|
PDB | 7vnm Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex. |
Chain | X |
Resolution | 2.86 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SPO |
X |
R20 V23 |
R5 V8 |
|
|
|
|