Structure of PDB 7vbp Chain X |
>7vbpX (length=88) Species: 9823 (Sus scrofa) [Search protein sequence] |
SDAPPLTLEAIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEI IMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE |
|
PDB | 7vbp The coupling mechanism of mammalian mitochondrial complex I. |
Chain | X |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
8Q1 |
X |
D111 S112 |
D43 S44 |
|
|
|
|