Structure of PDB 7rf7 Chain X

Receptor sequence
>7rf7X (length=38) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQR
3D structure
PDB7rf7 Structural dynamics in the water and proton channels of photosystem II during the S 2 to S 3 transition.
ChainX
Resolution2.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA X G13 L14 L15 A18 G12 L13 L14 A17
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7rf7, PDBe:7rf7, PDBj:7rf7
PDBsum7rf7
PubMed34764256
UniProtQ9F1R6|PSBX_THEVB Photosystem II reaction center protein X (Gene Name=psbX)

[Back to BioLiP]