Structure of PDB 7q5y Chain X

Receptor sequence

>7q5yX (length=135) Species: 224324 (Aquifex aeolicus VF5)

WGRRNSLWPVTIGLACCAIEMMHTAASRFDLDRLGVIFRASPRQADVLIV
AGTVVNKVAPMLKLIWDQMPDPKWCISMGGCASAGGPFPTYSTLQGVDRI
IPVDVYIPGCPPTPQGLIYGILQLQRKIKEQGITK

3D structure

• PDB: 7q5y Structure of NADH:ubichinon oxidoreductase (complex I) of the hyperthermophilic eubacterium Aquifex aeolicus
• Chain: X
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	X	C35 C36 G71 T72 C100 C129 P130	C16 C17 G52 T53 C81 C110 P111

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0050136 NADH:ubiquinone reductase (non-electrogenic) activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009060 aerobic respiration
• GO:0015990 electron transport coupled proton transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7q5y, PDBe:7q5y, PDBj:7q5y
• PDBsum: 7q5y
• UniProt: O67334|NUOB_AQUAE NADH-quinone oxidoreductase subunit B (Gene Name=nuoB)