Structure of PDB 7nhm Chain X

Receptor sequence
>7nhmX (length=99) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQL
NPEGGILETEAAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGE
3D structure
PDB7nhm Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
ChainX
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X H2 K4 G14 K15 T26 K29 M41 K42 K43 H44 P47 H64 S66 N67 R80 K90 K95 H2 K4 G14 K15 T26 K29 M41 K42 K43 H44 P47 H64 S66 N67 R80 K90 K95
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhm, PDBe:7nhm, PDBj:7nhm
PDBsum7nhm
PubMed34117249
UniProtP60735|RL24_STAAN Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]