Structure of PDB 7nad Chain X

Receptor sequence
>7nadX (length=98) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
KKALKVRTSATFRLPRLDSYKVIEQPITSETAMKKVEDGNILVFQVSMKA
NKYQIKKAVKELYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANR
3D structure
PDB7nad Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
ChainX
Resolution3.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X T31 F32 R33 L34 P35 S69 K75 N91 K92 Y93 K109 N111 L113 V114 P116 K120 K121 Y123 R125 T11 F12 R13 L14 P15 S29 K35 N51 K52 Y53 K69 N71 L73 V74 P76 K80 K81 Y83 R85
BS02 rna X F32 R56 K61 K89 Y93 Q94 K97 F12 R16 K21 K49 Y53 Q54 K57
BS03 peptide X A30 T31 F32 A10 T11 F12
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nad, PDBe:7nad, PDBj:7nad
PDBsum7nad
PubMed36482249
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]