Structure of PDB 7msz Chain X

Receptor sequence
>7mszX (length=62) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
AAVCDICGKGPGFGKSVSHSHRRTSRRWDPNIQTVHAVTRPGGNKKRLNV
CTSCIKAGKITR
3D structure
PDB7msz Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
ChainX
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna X A2 A3 K10 F14 K16 S21 H22 R23 R24 R27 R28 W29 D30 P31 N32 Q34 T35 V36 H37 R41 N45 K46 R48 K57 R63 A1 A2 K9 F13 K15 S20 H21 R22 R23 R26 R27 W28 D29 P30 N31 Q33 T34 V35 H36 R40 N44 K45 R47 K56 R62
BS02 ZN X C5 C8 C55 C4 C7 C54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7msz, PDBe:7msz, PDBj:7msz
PDBsum7msz
PubMed35064151
UniProtP0DV54|RL28C_MYCTU Large ribosomal subunit protein bL28C (Gene Name=rpmB3)

[Back to BioLiP]