Structure of PDB 7m4y Chain X

Receptor sequence
>7m4yX (length=60) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
KTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQVARKTIA
RIKTLLTEKQ
3D structure
PDB7m4y Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
ChainX
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X R7 S40 H41 R47 K48 R52 K54 T55 R6 S39 H40 R46 K47 R51 K53 T54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m4y, PDBe:7m4y, PDBj:7m4y
PDBsum7m4y
PubMed34044590
UniProtB7IA31|RL29_ACIB5 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]