Structure of PDB 7f86 Chain X

Receptor sequence

>7f86X (length=184) Species: 1970092 (Halomicronema sp. R31DM) [Search protein sequence]

MLDAFSRAVVQADASTSVVGDVSALKQFIAQGNRRLDAVNAIASNASCMV
SDAIAGMICENQGLIQAGGNCYPNRRMAACLRDGEIILRYVTYALLAGDA
SVLDDRCLNGLKETYAALGVPTTSTVRAVQIMKAQAAAHIKDTPSEARAG
AKLRKMGSPVVEDRCSSLVAEASSYFDRVIAALS

3D structure

PDB

7f86 Crystal structure analysis of phycoerythrin from marine cyanobacterium Halomicronema .

Chain

Resolution

2.21 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	X	N33 R34 L36 D37 I140 K141 P159 V160 V161 C165	N33 R34 L36 D37 I140 K141 P159 V160 V161 C165
BS02	PEB	X	C48 D52 A55 G56 C59 I131 A134 Q135 H139 P144 S145 R148 A149 K152	C48 D52 A55 G56 C59 I131 A134 Q135 H139 P144 S145 R148 A149 K152
BS03	PEB	X	N70 C71 R75 R76 A79 C80 D83 I86 L118 V120 T125	N70 C71 R75 R76 A79 C80 D83 I86 L118 V120 T125

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7f86, PDBe:7f86, PDBj:7f86
PDBsum	7f86
PubMed	35354393
UniProt	A0A1W1IW87

[Back to BioLiP]