Structure of PDB 6yef Chain X

Receptor sequence
>6yefX (length=87) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
IKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQGGILETE
AAIHVSNVQLLDPKTNEPTRVGYKFVRIAKKSGEEIK
3D structure
PDB6yef Cryo-EM structure of the ribosome functional complex of the human pathogen Staphylococcus aureus at 3.2 angstrom resolution.
ChainX
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X K4 A13 G14 K15 M41 K42 K43 Q45 G55 H64 R80 V81 K2 A11 G12 K13 M39 K40 K41 Q43 G45 H54 R70 V71
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yef, PDBe:6yef, PDBj:6yef
PDBsum6yef
PubMed32852796
UniProtQ2FW17|RL24_STAA8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]