Structure of PDB 6xii Chain X

Receptor sequence
>6xiiX (length=116) Species: 562 (Escherichia coli) [Search protein sequence]
ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKPIK
3D structure
PDB6xii Structural basis of transcription-translation coupling.
ChainX
Resolution7.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X V25 G26 K27 T28 R87 R98 Q100 R101 T102 K103 T104 N105 R107 K110 R113 I116 V24 G25 K26 T27 R86 R97 Q99 R100 T101 K102 T103 N104 R106 K109 R112 I115
BS02 rna X M81 R92 R93 M80 R91 R92
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xii, PDBe:6xii, PDBj:6xii
PDBsum6xii
PubMed32820061
UniProtP0A7S9|RS13_ECOLI Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]