Structure of PDB 6w6l Chain X

Receptor sequence
>6w6lX (length=61) Species: 9606 (Homo sapiens) [Search protein sequence]
KVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINW
TVLYRRKHKKG
3D structure
PDB6w6l An ER translocon for multi-pass membrane protein biogenesis.
ChainX
Resolution3.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna X R19 K35 R44 N50 W51 R56 K61 R18 K34 R43 N49 W50 R55 K60
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045296 cadherin binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0010458 exit from mitosis
GO:0021554 optic nerve development
GO:0031290 retinal ganglion cell axon guidance
GO:0060041 retina development in camera-type eye
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6l, PDBe:6w6l, PDBj:6w6l
PDBsum6w6l
PubMed32820719
UniProtP83731|RL24_HUMAN Large ribosomal subunit protein eL24 (Gene Name=RPL24)

[Back to BioLiP]