Structure of PDB 6qt0 Chain X

Receptor sequence

>6qt0X (length=125) Species: 4932 (Saccharomyces cerevisiae)

AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGKL

3D structure

• PDB: 6qt0 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
• Chain: X
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	A2 Q4 L6 V8 S9 S10 R12 K14 A15 R16 Y19 V29 S32 K46 R60 G61 S62 K89 V90 H100 S102 K103 R121 K122	A1 Q3 L5 V7 S8 S9 R11 K13 A14 R15 Y18 V28 S31 K45 R59 G60 S61 K88 V89 H99 S101 K102 R120 K121
BS02	rna	X	R13 R16 K17 F20 P23 S24 S25 R51 R52 Y74 R75 D112 K113 D114 K116	R12 R15 K16 F19 P22 S23 S24 R50 R51 Y73 R74 D111 K112 D113 K115

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6qt0, PDBe:6qt0, PDBj:6qt0
• PDBsum: 6qt0
• PubMed: 31115337
• UniProt: P05743|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)