Structure of PDB 6k61 Chain X

Receptor sequence
>6k61X (length=31) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
AKPPYTFRTGWALLLLAVNFLVAAYYFHIIQ
3D structure
PDB6k61 Structural and functional insights into the tetrameric photosystem I from heterocyst-forming cyanobacteria.
ChainX
Resolution2.37 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA X L29 N32 F33 Y39 F40 L16 N19 F20 Y26 F27
BS02 CLA X R21 L28 R8 L15
BS03 CLA X L28 N32 L15 N19
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k61, PDBe:6k61, PDBj:6k61
PDBsum6k61
PubMed31595062
UniProtP58566|PSAX_NOSS1 Photosystem I 4.8 kDa protein (Gene Name=psaX)

[Back to BioLiP]