Structure of PDB 6fai Chain X

Receptor sequence

>6faiX (length=144) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKG
IVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDE
VLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS

3D structure

PDB

6fai Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	X	G2 K3 G4 K5 P6 R7 G8 N10 R13 K14 R19 R20 N22 R23 W24 A25 E26 K30 R32 F38 S46 S47 A49 K50 N65 S66 I68 R69 K82 F86 G91 C92 L103 G106 G108 R109 K110 G111 K112 R121 K123 K126 S131 K139 K140	G1 K2 G3 K4 P5 R6 G7 N9 R12 K13 R18 R19 N21 R22 W23 A24 E25 K29 R31 F37 S45 S46 A48 K49 N64 S65 I67 R68 K81 F85 G90 C91 L102 G105 G107 R108 K109 G110 K111 R120 K122 K125 S130 K138 K139

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation
GO:0006450	regulation of translational fidelity
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6fai, PDBe:6fai, PDBj:6fai
PDBsum	6fai
PubMed	29459436
UniProt	P0CX29\|RS23A_YEAST Small ribosomal subunit protein uS12A (Gene Name=RPS23A)