Structure of PDB 5ybd Chain X

Receptor sequence
>5ybdX (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
QIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPN
MNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALLEHH
3D structure
PDB5ybd Comparative structure analysis of the ETSi domain of ERG3 and its complex with the E74 promoter DNA sequence
ChainX
Resolution2.769 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna X Y362 R367 R370 Y373 K380 R385 Y386 Y53 R58 R61 Y64 K71 R76 Y77
BS02 dna X Q312 L313 W351 K355 M360 D363 K364 Y371 Y372 K375 Q3 L4 W42 K46 M51 D54 K55 Y62 Y63 K66
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ybd, PDBe:5ybd, PDBj:5ybd
PDBsum5ybd
PubMed30279318
UniProtP11308|ERG_HUMAN Transcriptional regulator ERG (Gene Name=ERG)

[Back to BioLiP]