Structure of PDB 5vcb Chain X

Receptor sequence

>5vcbX (length=77) Species: 585035 (Escherichia coli S88)

STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEF
DTEIPDEEAEKITTVQAAIDYINGHQA

3D structure

• PDB: 5vcb Structure, High Affinity, and Negative Cooperativity of the Escherichia coli Holo-(Acyl Carrier Protein):Holo-(Acyl Carrier Protein) Synthase Complex.
• Chain: X
• Resolution: 4.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D35
• Catalytic site (residue number reindexed from 1): D35

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PNS	X	S36 E57 E60	S36 E57 E60

Gene Ontology

Molecular Function

• GO:0000035 acyl binding
• GO:0000036 acyl carrier activity
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0031177 phosphopantetheine binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0009245 lipid A biosynthetic process
• GO:0009410 response to xenobiotic stimulus

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5vcb, PDBe:5vcb, PDBj:5vcb
• PDBsum: 5vcb
• PubMed: 29054754
• UniProt: P0A6A8|ACP_ECOLI Acyl carrier protein (Gene Name=acpP)