Structure of PDB 5t5h Chain X

Receptor sequence

>5t5hX (length=109) Species: 5693 (Trypanosoma cruzi) [Search protein sequence]

AYTRPQFRRPHTYRRPSMSAISNKWDAFRVIRYPLTTDKAMKKIEENNTL
TFIVDSNANKTEIKKAMRKLYQVKAVKVNTLIRPDGLKKAYIRLSASYDA
LETANKMGL

3D structure

PDB

5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.

Chain

Resolution

2.54 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	X	R81 Q83 F84 R85 R86 P87 H88 T89 R91 R92 T121 D122 K123 K127 N131 K144 V160 K161 N163 T164 L165 P168 K173 Y175 R177	R4 Q6 F7 R8 R9 P10 H11 T12 R14 R15 T37 D38 K39 K43 N47 K60 V76 K77 N79 T80 L81 P84 K89 Y91 R93
BS02	rna	X	P82 Q83 N143 K144 T145 K148 I166 K172	P5 Q6 N59 K60 T61 K64 I82 K88
BS03	rna	X	Y79 P87 T89 Y90 R92 N107 K108 R113 S140 T145 E146 K149	Y2 P10 T12 Y13 R15 N23 K24 R29 S56 T61 E62 K65

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links